ShopDreamUp AI ArtDreamUp
Deviation Actions
![(The) Falcon [With Wings]](https://images-wixmp-ed30a86b8c4ca887773594c2.wixmp.com/f/6aebafb0-875a-4fdf-a927-ffe4d819f7a1/da27wq9-7eed07e0-267a-4bbd-842f-61f9af4a673b.png/v1/crop/w_92,h_92,x_10,y_0,scl_0.037096774193548/_the__falcon__with_wings__by_kyle_a_mcdonald_da27wq9-92s.png?token=eyJ0eXAiOiJKV1QiLCJhbGciOiJIUzI1NiJ9.eyJzdWIiOiJ1cm46YXBwOjdlMGQxODg5ODIyNjQzNzNhNWYwZDQxNWVhMGQyNmUwIiwiaXNzIjoidXJuOmFwcDo3ZTBkMTg4OTgyMjY0MzczYTVmMGQ0MTVlYTBkMjZlMCIsIm9iaiI6W1t7ImhlaWdodCI6Ijw9MjQ4MCIsInBhdGgiOiJcL2ZcLzZhZWJhZmIwLTg3NWEtNGZkZi1hOTI3LWZmZTRkODE5ZjdhMVwvZGEyN3dxOS03ZWVkMDdlMC0yNjdhLTRiYmQtODQyZi02MWY5YWY0YTY3M2IucG5nIiwid2lkdGgiOiI8PTM1MDgifV1dLCJhdWQiOlsidXJuOnNlcnZpY2U6aW1hZ2Uub3BlcmF0aW9ucyJdfQ.J2WKxOcs8qs4gGyY5YHaOISNI0AoeaxcwOKoxhzNCWk)
Suggested Deviants
Suggested Collections
You Might Like…
Featured in Groups
antmancaptainamericadigitaldrawingsdynefanhankpymhopelangmarvelmarvelcomicsmarveluniversemaximoffmcumoviespietromaximoffpolarisquicksilverscottthanosultronvanvisionbaronzemothefalconthewaspwintersoldieravengersassembleavengersironmanvandynemarvelsuperherojanetvandynequicksilvermarvelcomicscivilwarmarvelantmanantmanjanetvandynewaspmarvelcinematicuniverseavengerscaptainamericaavengershawkeyeavengerslokiavengersthorcaptainamericathewintersoldierant_manavengersageofultronwintersoldierbuckybarnesartantmanmarvelcaptainamericacivilwarantmanmovieantmanhankpymhopevandyneantmanandthewaspantmanmovie_2015antmanxreaderteamcapitainamericateamcapbaronzemocivilwarfalconwintersoldierteamcaptainamericamarvelphoenixstudios91civilwarphoenixstudios91hopevandynemarvelhopevandynewaspwaspmarvel
Description
New Project I started to get myself back into drawing and using Photoshop (there are something's you just don't forget).
The Project is basically taking Marvel Characters and applying them to the MCU using the same art style as seen in the animated series "Avengers Assemble".
characters who already exist within the MCU will largely remain untouched however those who do not/ have not worn a costume yet will result in some type of amalgam of their existing Comic book looks.
This is (The) Wasp aka. Hope Van Dyne (-Pym)as her suit appears in Marvel's "Ant-Man"'s post-credit scene with minor alterations and changes,
The Original Wasp: Janet Van Dyne (-Pym) also appears in Marvel's "Ant-Man" albiet in a flashback sequence and not in person, her daughter is due to take over the mantle of (The) Wasp in Marvel's "Ant-Man and The Wasp"
Hope van Dyne (-Pym) is portrayed by Evangeine Lilly
Click here to find out more about the Original Wasp: Janet Van Dyne (-Pym)
Click here to find out more about the MCU version of the Wasp: Hope Van Dyne (-Pym)
The Project is basically taking Marvel Characters and applying them to the MCU using the same art style as seen in the animated series "Avengers Assemble".
characters who already exist within the MCU will largely remain untouched however those who do not/ have not worn a costume yet will result in some type of amalgam of their existing Comic book looks.
This is (The) Wasp aka. Hope Van Dyne (-Pym)as her suit appears in Marvel's "Ant-Man"'s post-credit scene with minor alterations and changes,
The Original Wasp: Janet Van Dyne (-Pym) also appears in Marvel's "Ant-Man" albiet in a flashback sequence and not in person, her daughter is due to take over the mantle of (The) Wasp in Marvel's "Ant-Man and The Wasp"
Hope van Dyne (-Pym) is portrayed by Evangeine Lilly
Click here to find out more about the Original Wasp: Janet Van Dyne (-Pym)
Click here to find out more about the MCU version of the Wasp: Hope Van Dyne (-Pym)
Image size
2480x3508px 1.08 MB
© 2016 - 2024 Kyle-A-McDonald
Comments11
Join the community to add your comment. Already a deviant? Log In
Thats Gonna Sting.